You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583210 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SH3GL2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SH3GL2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | SH3GL2 |
UniProt ID | Q99962 |
Protein Sequence | Synthetic peptide located within the following region: PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD |
NCBI | NP_003017 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CNSA2, SH3P4, EEN-B1, SH3D2A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: SH3GL2, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: SH3GL2, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
WB Suggested Anti-SH3GL2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate. SH3GL2 is supported by BioGPS gene expression data to be expressed in HeLa.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating