SH3GL2 antibody

• Catalog Number: orb583209
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SH3GL2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: SH3GL2
• UniProt ID: Q99962
• Protein Sequence: Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
• NCBI: NP_003017
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CNSA2, SH3P4, EEN-B1, SH3D2A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SH3GL2, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

Host: Rat, Target Name: SH3GL2, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-SH3GL2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.