You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582775 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Sgms1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse Sgms1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49 kDa |
Target | Sgms1 |
UniProt ID | Q8VCQ6 |
Protein Sequence | Synthetic peptide located within the following region: LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL |
NCBI | NP_659041 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SM, Mob, Sms1, Sor1, SMS1b, SMS1g, C80702, Tmem23, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in 49 kDa, 32 kDa and 25 kDa forms. Protein may be phosphorylated.
25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in 49 kDa, 32 kDa and 25 kDa forms. Protein may be phosphorylated.
WB Suggested Anti-Sgms1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Muscle.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating