You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582774 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SGMS1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SGMS1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49 kDa |
Target | SGMS1 |
UniProt ID | Q86VZ5 |
Protein Sequence | Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI |
NCBI | NP_671512 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MOB, MOB1, SMS1, TMEM23, hmob33 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Smaller isoforms of 25 to 28 kDa also contain this peptide sequence.
Host: Rabbit, Target Name: SGMS1, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: SGMS1, Positive control (+): Human heart (HE), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
WB Suggested Anti-SGMS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. SGMS1 is supported by BioGPS gene expression data to be expressed in HeLa.
ELISA, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating