You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579773 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SGCE |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SGCE |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50 kDa |
Target | SGCE |
UniProt ID | B5MDA7 |
Protein Sequence | Synthetic peptide located within the following region: TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI |
NCBI | NP_001092871 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ESG, DYT11, epsilon-SG Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: FAM46C, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: WT1, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SGCE is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target: SGCE, Positive control (+): Human Fetal Heart (HE), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.
Immunohistochemistry with cerebellum tissue.
Immunohistochemistry with pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0 ug/ml using anti-SGCE antibody (orb579773).
WB Suggested Anti-SGCE Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. SGCE is supported by BioGPS gene expression data to be expressed in 721_B.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating