You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578047 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SFTPB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep |
Reactivity | Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SFTPB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42 kDa |
Target | SFTPB |
UniProt ID | P07988 |
Protein Sequence | Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV |
NCBI | NP_000533 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SP-B, PSP-B, SFTB3, SFTP3, SMDP1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.4 ug/ml of the antibody was used in this experiment. Protein is glycosylated, and processed to yield a propeptide and a mature chain.
25 ug of the indicated Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.4 ug/ml of the antibody was used in this experiment. Protein is glycosylated.
Host: Mouse, Target Name: SFTPB, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: SFTPB, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.
SFTPB antibody - middle region (orb578047), Catalog Number: orb578047, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of pneumocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SFTPB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate.
Filter by Rating