SFRP2 antibody

• Catalog Number: orb330862
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SFRP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: SFRP2
• UniProt ID: Q96HF1
• Protein Sequence: Synthetic peptide located within the following region: DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
• NCBI: NP_003004
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FRP-2 antibody, anti SARP1 antibody, anti SDF
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Jurkat cell lysate tissue using SFRP2 antibody

Host: Rabbit, Target Name: SFRP2, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: SFRP2, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-SFRP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.