You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577508 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SF3B1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 146 kDa |
Target | SF3B1 |
UniProt ID | O75533 |
Protein Sequence | Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR |
NCBI | NP_036565 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MDS, PRP10, Hsh155, PRPF10, SAP155, SF3b155 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also in an isoform of 54 kDa and the protein may be modified via citrullination, sumoylation, and/or phosphorylation.
Host: Rabbit, Target Name: SF3B1, Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-SF3B1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Epidermal cells, Antibody Concentration: 16 ug/ml, Magnification: 400X.
WB Suggested Anti-SF3B1 Antibody Titration: 1.25 ug/ml, Positive Control: Human Thymus.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Hamster, Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating