SETD2 Rabbit Polyclonal Antibody

• Catalog Number: orb330513
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SETD2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SETD2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 97kDa
• Target: SETD2
• UniProt ID: Q9BYW2
• Protein Sequence: Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD
• NCBI: AAH72440
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ16420 antibody, anti FLJ22472 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Hela (HL), Negative control (-): MCF7 (N10), Antibody concentration: 2.5 ug/mL.

Human HepG2 cellsSETD2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

SETD2 antibody - N-terminal region (orb330513) validated by IHC using Human Placenta lysate at 4.0-8.0.