You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330880 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SERPINI2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SERPINI2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 46kDa |
Target | SERPINI2 |
UniProt ID | O75830 |
Protein Sequence | Synthetic peptide located within the following region: LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF |
NCBI | NP_006208 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MEPI antibody, anti PANCPIN antibody, anti PI Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of COLO205 cell lysate tissue using SERPINI2 antibody
WB Suggested Anti-SERPINI2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate, SERPINI2 is supported by BioGPS gene expression data to be expressed in COLO205.
ICC, IF, IHC, WB | |
Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Mouse, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating