SERPINB1 monoclonal antibody (M02), clone 4D7

• Catalog Number: orb2293260
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SERPINB1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4D7
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: SERPINB1 (NP_109591.1, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
• NCBI: NP_109591.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SERPINB1 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SERPINB1 on HeLa cell. [antibody concentration 40 ug/ml]

Western Blot analysis of SERPINB1 expression in transfected 293T cell line by SERPINB1 monoclonal antibody (M02), clone 4D7. Lane 1: SERPINB1 transfected lysate (42.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).