You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1536200 |
---|---|
Category | Antibodies |
Description | SEPT9 / Septin 9 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, IHC-P, WB |
Reactivity | Human |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SEPT9 (NP_001106964.1). MEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPV |
Dilution range | IHC, IHC-P (1:100), WB (1:500 - 1:2000) |
Conjugation | Unconjugated |
Target | SEPT9 / Septin 9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol |
Alternative names | SEPT9, AF17q25, Ov/Br septin, PNUTL4, KIAA0991, Se Read more... |
Note | For research use only |
Application notes | Further information: The predicted MW is 38kDa/41kDa/47kDa/52kDa/63kDa/64kDa/65kDa, while the observed MW by Western blot was 75kDa. |
Expiration Date | 12 months from date of receipt. |
Filter by Rating