SEPT9 / Septin 9 Antibody

• Catalog Number: orb1536200
• Category: Antibodies
• Description: SEPT9 / Septin 9 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Human
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SEPT9 (NP_001106964.1). MEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPV
• Dilution range: IHC, IHC-P (1:100), WB (1:500 - 1:2000)
• Conjugation: Unconjugated
• Target: SEPT9 / Septin 9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: SEPT9, AF17q25, Ov/Br septin, PNUTL4, KIAA0991, Se
• Note: For research use only
• Application notes: Further information: The predicted MW is 38kDa/41kDa/47kDa/52kDa/63kDa/64kDa/65kDa, while the observed MW by Western blot was 75kDa.
• Expiration Date: 12 months from date of receipt.