SEPT9 antibody

• Catalog Number: orb325685
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SEPT9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SEPT9(septin 9)
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: SEPT9
• UniProt ID: Q9UHD8
• Protein Sequence: Synthetic peptide located within the following region: HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK
• NCBI: NP_001106968
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AF17q25 antibody, anti KIAA0991 antibody, ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SEPT9, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: SEPT9, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-SEPT9(septin 9) Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate, SEPT9(septin 9) is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.