You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb55702 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SEPT2 . |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | SEPT2 |
UniProt ID | Q15019 |
Protein Sequence | Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK |
NCBI | NP_006146 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DIFF6, NEDD5, SEPT2, NEDD-5, Pnutl3, hNedd5 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 1. Human Cervical Cancer Cell Lysate (15 ug), 2. Monkey Fibroblast Cell Lysate (15 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-Rabbit, Secondary dilution: 1:40000.
Host: Rabbit, Target Name: SEPT2, Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. SEPT2 is supported by BioGPS gene expression data to be expressed in HEK293T.
Host: Rabbit, Target Name: SEPT2, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. SEPT2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: SEPT2, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-SEPT2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.SEPT2 is strongly supported by BioGPS gene expression data to be expressed in HepG2.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating