SEPT2 antibody

• Catalog Number: orb55702
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SEPT2 .
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: SEPT2
• UniProt ID: Q15019
• Protein Sequence: Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
• NCBI: NP_006146
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DIFF6, NEDD5, SEPT2, NEDD-5, Pnutl3, hNedd5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 1. Human Cervical Cancer Cell Lysate (15 ug), 2. Monkey Fibroblast Cell Lysate (15 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-Rabbit, Secondary dilution: 1:40000.

Host: Rabbit, Target Name: SEPT2, Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. SEPT2 is supported by BioGPS gene expression data to be expressed in HEK293T.

Host: Rabbit, Target Name: SEPT2, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. SEPT2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Host: Rabbit, Target Name: SEPT2, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-SEPT2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.SEPT2 is strongly supported by BioGPS gene expression data to be expressed in HepG2.