You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb55705 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SEPT11 . |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT11(septin 11) |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49kDa |
Target | SEPT11 |
UniProt ID | Q9NVA2 |
Protein Sequence | Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET |
NCBI | NP_060713 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | 45180 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SEPT11, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SEPT11, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.
Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SEPT11(septin 11) antibody (orb55705).
SEPT11 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb55705 with 1:200 dilution. Western blot was performed using orb55705 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: SEPT11 IP with orb55705 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-SEPT11(septin 11) Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.
ELISA, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating