You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580344 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SELENBP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SELENBP1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 44kDa |
Target | SELENBP1 |
UniProt ID | Q13228 |
Protein Sequence | Synthetic peptide located within the following region: KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR |
NCBI | AAH32997 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MTO, LPSB, SP56, hSBP, EHMTO, SBP56, HEL-S-134P Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: FAM46C, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NOP56, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7.
Host: Rabbit, Target Name: SELENBP1, Sample Tissue: Human 721_B, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SERPINA3, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-SELENBP1 Antibody, Catalog Number: orb580344, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic, membrane and nuclear in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SELENBP1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
ELISA, FC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating