SEC61A1 antibody

• Catalog Number: orb326528
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SEC61A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC61A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: SEC61A1
• UniProt ID: P61619
• Protein Sequence: Synthetic peptide located within the following region: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC
• NCBI: NP_037468
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSEC61 antibody, anti SEC61 antibody, anti SE
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SEC61A1, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: SEC61A1, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-SEC61A1 Antibody, Titration: 1.0 ug/mL, Positive Control: HT1080 Whole Cell, SEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080.