You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326528 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SEC61A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC61A1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52kDa |
Target | SEC61A1 |
UniProt ID | P61619 |
Protein Sequence | Synthetic peptide located within the following region: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC |
NCBI | NP_037468 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HSEC61 antibody, anti SEC61 antibody, anti SE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SEC61A1, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: SEC61A1, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-SEC61A1 Antibody, Titration: 1.0 ug/mL, Positive Control: HT1080 Whole Cell, SEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080.
ICC, IHC-Fr, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Canine, Human, Porcine | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Canine, Porcine | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
ICC, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating