SDHB antibody

• Catalog Number: orb330526
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SDHB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SDHB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32 kDa
• Target: SDHB
• UniProt ID: P21912
• Protein Sequence: Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE
• NCBI: NP_002991
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti IP antibody, anti PGL4 antibody, anti SDH ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: FAM46C, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: GNAS, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: SDHB, Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: SERPINA3, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target: SDHB, Positive control (+): Human Liver (LI), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml.

WB Suggested Anti-SDHB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, SDHB is supported by BioGPS gene expression data to be expressed in Jurkat.