SCP2 antibody

• Catalog Number: orb330861
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SCP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Guinea pig, Human, Mouse, Rat, Zebrafish
• Reactivity: Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: SCP2
• UniProt ID: Q6NXF4
• Protein Sequence: Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA
• NCBI: NP_001007099
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp686C12188 antibody, anti DKFZp686D11188
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of MCF7 cell lysate tissue using SCP2 antibody

Western blot analysis of human Placenta tissue using SCP2 antibody

Western blot analysis of human Fetal Lung tissue using SCP2 antibody

Host: Rabbit, Target Name: SCP2, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: SCP2, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-SCP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.