SCP2 antibody

• Catalog Number: orb330860
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SCP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Rat
• Reactivity: Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: SCP2
• UniProt ID: A6NM69
• Protein Sequence: Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI
• NCBI: NP_001180529
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NLTP antibody, anti NSL-TP antibody, anti SCP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Thymus Tumor tissue using SCP2 antibody

Host: Rabbit, Target Name: SCP2, Sample Type: Thymus Tumor lysates, Antibody dilution: 1.0 ug/ml.