You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330860 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SCP2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Guinea pig, Human, Mouse, Rat |
Reactivity | Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCP2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | SCP2 |
UniProt ID | A6NM69 |
Protein Sequence | Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI |
NCBI | NP_001180529 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti NLTP antibody, anti NSL-TP antibody, anti SCP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Thymus Tumor tissue using SCP2 antibody
Host: Rabbit, Target Name: SCP2, Sample Type: Thymus Tumor lysates, Antibody dilution: 1.0 ug/ml.
WB | |
Animal, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Bovine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating