SCN8A antibody

• Catalog Number: orb575409
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SCN8A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCN8A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 225kDa
• Target: SCN8A
• UniProt ID: Q9UQD0
• Protein Sequence: Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC
• NCBI: NP_055006
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MED, PN4, CIAT, BFIS5, DEE13, NaCh6, CERIII, EIEE1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SCN8A, Sample Type: NCI-H226, Antibody dilution: 1.0 ug/ml. SCN8A is supported by BioGPS gene expression data to be expressed in NCIH226.

WB Suggested Anti-SCN8A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.