SCARB2 polyclonal antibody (A01)

• Catalog Number: orb2294808
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant SCARB2.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human
• Immunogen: SCARB2 (NP_005497, 339 a.a. ~ 437 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN
• NCBI: NP_005497
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

SCARB2 polyclonal antibody (A01). Western Blot analysis of SCARB2 expression in human stomach.

Western Blot analysis of SCARB2 expression in transfected 293T cell line by SCARB2 polyclonal antibody (A01). Lane 1: SCARB2 transfected lysate(54.159 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37 KDa).