SATB1 antibody

• Catalog Number: orb576574
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SATB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SATB1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 86 kDa
• Target: SATB1
• UniProt ID: Q01826
• Protein Sequence: Synthetic peptide located within the following region: VDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD
• NCBI: NP_002962
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DEFDA, KTZSL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in 3 isoforms including 89 kDa, 86 kDa, and 78 kDa. The protein may be modified by phosphorylation and/or sumoylation.

Host: Rabbit, Target Name: SATB1, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 0.625 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 6%-18%. SATB1 is supported by BioGPS gene expression data to be expressed in Jurkat.

Host: Rabbit, Target: SATB1, Positive control (+): 293T (2T), Negative control (-): A549 (N03), Antibody concentration: 3 ug/ml.

WB Suggested Anti-SATB1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. SATB1 is supported by BioGPS gene expression data to be expressed in Jurkat.