You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb738433 |
---|---|
Category | Antibodies |
Description | SARS-CoV-2 NSP9 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
UniProt ID | P0DTC1, P0DTD1 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Replicase polyprotein 1ab; pp1ab; ORF1ab polyprote Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
ELISA, WB | |
Virus | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating