RYBP antibody

• Catalog Number: orb576915
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RYBP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RYBP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: RYBP
• UniProt ID: Q8N488
• Protein Sequence: Synthetic peptide located within the following region: STSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF
• NCBI: NP_036366
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AAP1, DEDAF, YEAF1, APAP-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1. 50 ug 38B9 cell lysate, 2. 50 ug CH12 cell lysate, 3. 50 ug HeLa cell lysate, 4. Purified RYBP Protein, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:30000, Gene Name: RYBP.

WB Suggested Anti-RYBP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.