You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330317 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RXRA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Reactivity | Canine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RXRA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | RXRA |
UniProt ID | P19793 |
Protein Sequence | Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
NCBI | NP_002948 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ16020 antibody, anti FLJ16733 antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Heart tissue using RXRA antibody
Western blot analysis of human Fetal Liver tissue using RXRA antibody
Western blot analysis of human Fetal Lung tissue using RXRA antibody
Western blot analysis of HepG2 cell lysate tissue using RXRA antibody
Western blot analysis of human MCF7 tissue using RXRA antibody
Western blot analysis of human Fetal Muscle tissue using RXRA antibody
Host: Rabbit, Target Name: RXRA, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: RXRA, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: RXRA, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: RXRA, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: RXRA, Sample Type: Human MCF7, Antibody Dilution: 1.0 ug/mL, RXRA is strongly supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, RXRA is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat | |
Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating