RXRA antibody

• Catalog Number: orb329759
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RXRA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RXRA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: RXRA
• UniProt ID: P19793
• Protein Sequence: Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF
• NCBI: NP_002948
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ16020 antibody, anti FLJ16733 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Liver tissue using RXRA antibody

Western blot analysis of human Placenta tissue using RXRA antibody

Western blot analysis of Transfected 293T tissue using RXRA antibody

Western blot analysis of human Fetal Heart tissue using RXRA antibody

Western blot analysis of human Fetal Lung tissue using RXRA antibody

Host: Rabbit, Target Name: RXRA, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: RXRA, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: RXRA, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: RXRA, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Host: Rat, Target Name: RXRA, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T.