You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574170 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RUVBL2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | RUVBL2 |
UniProt ID | Q9Y230 |
Protein Sequence | Synthetic peptide located within the following region: IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID |
NCBI | NP_006657 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: RUVBL2, Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Human Liver
Rabbit Anti-RUVBL2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-RUVBL2 Antibody, Positive Control: Lane 1: 30 ug K562 lysate, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:1000.
WB Suggested Anti-RUVBL2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating