You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574169 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RUVBL2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | RUVBL2 |
UniProt ID | Q9Y230 |
Protein Sequence | Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI |
NCBI | NP_006657 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Lung
Human urinary bladder
Sample Type: Lane 1: 20 ug untransfected H1299 cells, Lane 2: 20 ug siRUVBL2 transfected H1299 cells Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:3000 Color/Signal Descriptions: RUVBL2.
WB Suggested Anti-RUVBL2 Antibody Titration: 2.0-4.0 ug/ml, Positive Control: Daudi cell lysate, RUVBL2 is supported by BioGPS gene expression data to be expressed in Daudi.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating