You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592889 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RUNX1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RUNX1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49 kDa |
Target | RUNX1 |
UniProt ID | B2RMS4 |
Protein Sequence | Synthetic peptide located within the following region: ASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT |
NCBI | NP_001745 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AM Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: RUNX1, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: Mouse embryonic d13 spinal motor neurons, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti rabbit IgG Alexa 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: RUNX1: Red LSL1: Green, Gene Name: RUNX1.
WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: SH-SYSY cell lysate.
WB Suggested Anti-RUNX1 Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Human LCL and mouse brains.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
FC, ICC, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating