RTCB antibody

• Catalog Number: orb326117
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RTCB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf28
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55 kDa
• Target: RTCB
• UniProt ID: Q9Y3I0
• Protein Sequence: Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
• NCBI: NP_055121
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DJ149A16.6 antibody, anti HSPC117 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Hela tissue using RTCB antibody

Western blot analysis of HepG2 cell lysate tissue using RTCB antibody

Immunohistochemical staining of human Bronchial Epithelial tissue using RTCB antibody

Western blot analysis of human Fetal Lung tissue using RTCB antibody

Western blot analysis of human Jurkat tissue using RTCB antibody

Host: Rabbit, Target Name: C22orf28, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be modified by phosphorylation.

Host: Rabbit, Target Name: C22orf28, Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: C22orf28, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: C22orf28, Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, RTCB is supported by BioGPS gene expression data to be expressed in HeLa.

Host: Rabbit, Target Name: C22orf28, Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, RTCB is supported by BioGPS gene expression data to be expressed in Jurkat.

Rabbit Anti-C22orf28 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 10 ug/mL.

Rabbit Anti-C22orf28 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 10 ug/mL.

Rabbit Anti-RTCB Antibody, Catalog Number: orb326117, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-C22orf28 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.