You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585971 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RPS17 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 16 kDa |
Target | RPS17 |
UniProt ID | P0CW22 |
Protein Sequence | Synthetic peptide located within the following region: PVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSL |
NCBI | NP_001012 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | S17, DBA4, RPS17L, RPS17L1, RPS17L2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: RPS17, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: RPS17, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 0.5 ug/ml.
WB Suggested Anti-RPS17 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. RPS17 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ELISA, FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Gallus, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating