You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574714 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RPS16 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RPS16 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 16kDa |
Target | RPS16 |
UniProt ID | P62249 |
Protein Sequence | Synthetic peptide located within the following region: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL |
NCBI | NP_001011 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | S16 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: RPS16, Sample Type: Jurkat cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 4.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Host: Rabbit, Target Name: RPS16, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 10-20%.
Human Lung
Rabbit Anti-RPS16 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-RPS16 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Canine, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rat |
Filter by Rating