RPS14 antibody

• Catalog Number: orb577534
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPS14
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPS14
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: RPS14
• UniProt ID: P62263
• Protein Sequence: Synthetic peptide located within the following region: GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
• NCBI: NP_001020242
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: S14, EMTB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: RPS14, Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. RPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Host: Rabbit, Target Name: RPS14, Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in HeLa.

Host: Rabbit, Target Name: RPS14, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: RPS14, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: RPS14, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: RPS14, Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in Jurkat.

Host: Rabbit, Target Name: RPS14, Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-RPS14 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.