You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586422 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RPL36AL |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL36AL |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 12kDa |
Target | RPL36AL |
UniProt ID | Q969Q0 |
Protein Sequence | Synthetic peptide located within the following region: FRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQ |
NCBI | NP_000992 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RPL36A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: RPL36A, Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. RPL36AL is supported by BioGPS gene expression data to be expressed in HEK293T.
Host: Rabbit, Target Name: RPL36A, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. RPL36AL is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: RPL36A, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RPL36A, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RPL36A, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RPL36A, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-RPL36AL Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell. RPL36AL is supported by BioGPS gene expression data to be expressed in Jurkat.
ICC, IF, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating