Cart summary

You have no items in your shopping cart.

    RPL13A Peptide - middle region

    RPL13A Peptide - middle region

    Catalog Number: orb1999945

    DispatchUsually dispatched within 5-10 working days
    $ 269.00
    Catalog Numberorb1999945
    CategoryProteins
    DescriptionRPL13A Peptide - middle region
    Predicted ReactivityHuman
    Form/AppearanceLyophilized powder
    MW22 kDa
    UniProt IDP40429
    Protein SequenceSynthetic peptide located within the following region: YLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLK
    NCBINP_001257420.1
    StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
    Buffer/PreservativesLyophilized powder
    Alternative namesL13A, TSTA1
    Read more...
    NoteFor research use only
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars