Cart summary

You have no items in your shopping cart.

    RPA70/RPA1 Antibody

    Catalog Number: orb334619

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb334619
    CategoryAntibodies
    DescriptionRPA70/RPA1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, WB
    ReactivityHuman
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW68138 MW
    UniProt IDP27694
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesReplication protein A 70 kDa DNA-binding subunit;R
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    RPA70/RPA1 Antibody

    Flow Cytometry analysis of U251 cells using anti-RPA70 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

    RPA70/RPA1 Antibody

    WB analysis of RPA70 using anti-RPA70 antibody.Lane 1:human HeLa cell; 2:human K562 cell; 3:human HepG2 cell; 4:human 293T cell.

    RPA70/RPA1 Antibody

    IF analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in an immunocytochemical section of A549 cells.

    • RPA70 RPA1 Antibody (monoclonal, 11H4) [orb507562]

      FC,  IF,  IHC,  WB

      Human, Monkey, Mouse

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    • RPA70/RPA1 polyclonal antibody [orb1722547]

      IP,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 50 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars