Cart summary

You have no items in your shopping cart.

    RPA70 RPA1 Antibody (monoclonal, 11H4)

    Catalog Number: orb507562

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb507562
    CategoryAntibodies
    DescriptionRPA70 RPA1 Antibody (monoclonal, 11H4)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number11H4
    Tested applicationsFC, IF, IHC, WB
    ReactivityHuman, Monkey, Mouse
    IsotypeMouse IgG2b
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW12 kDa
    UniProt IDP27694
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesReplication protein A 70 kDa DNA-binding subunit;
    Read more...
    NoteFor research use only
    Application notesWestern blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x10^6 cells
    Expiration Date12 months from date of receipt.
    RPA70 RPA1 Antibody (monoclonal, 11H4)

    Flow Cytometry analysis of A431 cells using anti-RPA70 antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

    RPA70 RPA1 Antibody (monoclonal, 11H4)

    WB analysis of RPA70 using anti-RPA70 antibody.Lane 1:HELA cell; 2:MCF-7 cell; 3:K562 cell; 4:COS-7 cell; 5:Caco-2 cell; 6:A549 cell; 7:HEPG2 cell; 8:PC-3 cell; 9:HEPA1-6 cell.

    RPA70 RPA1 Antibody (monoclonal, 11H4)

    IF analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in immunocytochemical section of A549 cells.

    RPA70 RPA1 Antibody (monoclonal, 11H4)

    IHC analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in paraffin-embedded section of human intestinal cancer tissue.

    RPA70 RPA1 Antibody (monoclonal, 11H4)

    IHC analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in paraffin-embedded section of human lung cancer tissue.

    RPA70 RPA1 Antibody (monoclonal, 11H4)

    IHC analysis of RPA70 using anti-RPA70 antibody. RPA70 was detected in paraffin-embedded section of human lung cancer tissue.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars