RORC Rabbit Polyclonal Antibody

• Catalog Number: orb330428
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORC
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58 kDa
• Target: RORC
• UniProt ID: Q5SZR9
• Protein Sequence: Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
• NCBI: NP_001001523
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC129539 antibody, anti NR1F3 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Anti-ROR Gamma antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-ROR Gamma antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Positive control (+): Human lung (LU), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/mL.

WB Suggested Anti-RORC Antibody Titration: 1 ug/mL, Positive Control: HepG2 cell lysate.