RORA antibody

• Catalog Number: orb330425
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat
• Reactivity: Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RORA
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63kDa
• Target: RORA
• UniProt ID: P35398
• Protein Sequence: Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
• NCBI: NP_599022
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC119326 antibody, anti MGC119329 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human kidney tissue using RORA antibody

Western blot analysis of Jurkat tissue using RORA antibody

Western blot analysis of Jurkat cell lysate tissue using RORA antibody

Western blot analysis of Positive control (+): Human liver (LI) & Negative control (-): Human stomach (ST) using RORA antibody.

Host: Rabbit, Target Name: RORA, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Host: Rabbit, Target: RORA, Positive control (+): Human liver (LI), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.

Human kidney

WB Suggested Anti-RORA Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.