You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330424 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RORA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RORA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62kDa |
Target | RORA |
UniProt ID | P35398 |
Protein Sequence | Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI |
NCBI | NP_002934 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC119326 antibody, anti MGC119329 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HepG2 cell lysate tissue using RORA antibody
Immunohistochemical staining of human Pineal tissue using RORA antibody
Host: Rabbit, Target Name: RORA, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.
RORA antibody - middle region (orb330424), Catalog Number: orb330424, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nucleus in Human Pineal Tissue, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-RORA Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.
WB | |
Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat | |
Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Human, Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Human, Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating