RORA antibody

• Catalog Number: orb329792
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RORA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 59 kDa
• Target: RORA
• UniProt ID: P35398
• Protein Sequence: Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK
• NCBI: NP_599024
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC119326 antibody, anti MGC119329 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of 721_B cell lysate tissue using RORA antibody

Western blot analysis of human Placenta tissue using RORA antibody

Western blot analysis of human Fetal Heart tissue using RORA antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Host: Mouse, Target Name: RORA, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: RORA, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: RORA, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-RORA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, RORA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.