RNF39 antibody

• Catalog Number: orb325078
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RNF39
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF39
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: RNF39
• UniProt ID: A6NCD6
• Protein Sequence: Synthetic peptide located within the following region: CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL
• NCBI: NP_739576
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HZF antibody, anti HZFW antibody, anti LIRF a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 cell lysate tissue using RNF39 antibody

WB Suggested Anti-RNF39 Antibody Titration: 2.5 ug/mL, Positive Control: HepG2 cell lysate.