You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325078 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RNF39 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RNF39 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | RNF39 |
UniProt ID | A6NCD6 |
Protein Sequence | Synthetic peptide located within the following region: CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL |
NCBI | NP_739576 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HZF antibody, anti HZFW antibody, anti LIRF a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HepG2 cell lysate tissue using RNF39 antibody
WB Suggested Anti-RNF39 Antibody Titration: 2.5 ug/mL, Positive Control: HepG2 cell lysate.
Filter by Rating