You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575018 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RNF2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RNF2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | RNF2 |
UniProt ID | Q5TEN1 |
Protein Sequence | Synthetic peptide located within the following region: LVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGE |
NCBI | NP_009143 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BAP1, DING, BAP-1, HIPI3, RING2, RING1B Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
WB Suggested Anti-RNF2 antibody Titration: 1 ug/ml, Sample Type: Human Heart.
WB Suggested Anti-RNF2 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.
WB Suggested Anti-RNF2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
ChIP, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, Multiplex Assay, WB | |
Chinese Hamster, Human, Mouse | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating