RNF139 antibody

• Catalog Number: orb330280
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RNF139
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF139
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 76 kDa
• Target: RNF139
• UniProt ID: Q8WU17
• Protein Sequence: Synthetic peptide located within the following region: SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR
• NCBI: NP_009149
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HRCA1 antibody, anti MGC31961 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.

Host: Rabbit, Target: RNF139, Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 1 ug/mL.

WB Suggested Anti-RNF139 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, RNF139 is supported by BioGPS gene expression data to be expressed in MCF7.