Cart summary

You have no items in your shopping cart.

RNASEH2A Rabbit Polyclonal Antibody (FITC)

RNASEH2A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2125140

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2125140
CategoryAntibodies
DescriptionRNASEH2A Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RNASEH2A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW33kDa
UniProt IDO75792
Protein SequenceSynthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE
NCBINP_006388
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesAGS4, JUNB, RNHL, RNHIA, THSD8, RNASEHI
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.