You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324858 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RNASEH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RNASEH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32 kDa |
Target | RNASEH1 |
UniProt ID | O60930 |
Protein Sequence | Synthetic peptide located within the following region: EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED |
NCBI | NP_002927 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti H1RNA antibody, anti RNH1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.
Host: Rabbit, Target Name: RNASEH1, Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.
Rabbit Anti-RNASEH1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Uterus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-RNASEH1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, RNASEH1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ELISA, FC, ICC, IF, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating