You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592648 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RIPK3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Equine |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RIPK3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52 kDa |
Target | RIPK3 |
UniProt ID | Q9Y572 |
Protein Sequence | Synthetic peptide located within the following region: ETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST |
NCBI | NP_006862 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RIP3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse or Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein may be phosporylated, and the peptide has 92% identity for the rat Ripk3 sequence.
Host: Rat, Target Name: RIPK3, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.
Spleen
WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate.
ELISA, IF, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating