You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573829 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RIPK3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 57 kDa |
Target | RIPK3 |
UniProt ID | Q9Y572 |
Protein Sequence | Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG |
NCBI | NP_006862 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RIP3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: RIPK3, Sample Type: Lane 1: Transient overexpression lysate of RIPK3, Lane 2: Non-overexpressed vector control lysate, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: RIPK3, Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.
Human Heart
Human Liver
RIPK3 antibody - N-terminal region (orb573829), Catalog Number: orb573829, Formalin Fixed Paraffin Embedded Tissue: Human Pancreas Tissue, Observed Staining: Cytoplasmic in endocrine part (islets) of the pancreas. No staining observed in exocrine cells, Primary Antibody Concentration: 3 -12 ug/ml, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure: 0.2 seconds.
WB Suggested Anti-RIPK3 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.
WB Suggested Anti-RIPK3 antibody Titration: 1 ug/ml, Sample Type: Human Jurkat.
WB Suggested Anti-RIPK3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
ELISA, IF, IHC-P, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating