You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575233 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RIMS3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RIMS3 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 33kDa |
Target | RIMS3 |
UniProt ID | Q9UJD0 |
Protein Sequence | Synthetic peptide located within the following region: IMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLESATSPSCS |
NCBI | NP_055562 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NIM3, RIM3, RIM 3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
Human kidney
WB Suggested Anti-RIMS3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, RIMS3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ELISA, IF, IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating